NDUFB5 Antibody

Name NDUFB5 Antibody
Supplier Novus Biologicals
Catalog NBP1-59500
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen Synthetic peptides corresponding to NDUFB5(NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa) The peptide sequence was selected from the middle region of NDUFB5. Peptide sequence KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NDUFB5
Conjugate Unconjugated
Supplier Page Shop

Product images