Name | NDUFB5 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59500 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat |
Antigen | Synthetic peptides corresponding to NDUFB5(NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa) The peptide sequence was selected from the middle region of NDUFB5. Peptide sequence KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | NDUFB5 |
Conjugate | Unconjugated |
Supplier Page | Shop |