SLC25A29 Antibody

Name SLC25A29 Antibody
Supplier Novus Biologicals
Catalog NBP1-59499
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to SLC25A29(solute carrier family 25, member 29) The peptide sequence was selected from the C terminal of SLC25A29. Peptide sequence AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene SLC25A29
Supplier Page Shop

Product images