Name | SLC25A29 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59499 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Dog, Guinea Pig, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to SLC25A29(solute carrier family 25, member 29) The peptide sequence was selected from the C terminal of SLC25A29. Peptide sequence AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA. |
Purity/Format | IgG purified |
Description | Rabbit Polyclonal |
Gene | SLC25A29 |
Supplier Page | Shop |