SLC2A13 Antibody

Name SLC2A13 Antibody
Supplier Novus Biologicals
Catalog NBP1-59521
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC2A13(solute carrier family 2 (facilitated glucose transporter), member 13) The peptide sequence was selected from the middle region of SLC2A13. Peptide sequence GSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNA
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC2A13
Conjugate Unconjugated
Supplier Page Shop

Product images