MMP23B Antibody

Name MMP23B Antibody
Supplier Novus Biologicals
Catalog NBP1-59459
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MMP23B(matrix metallopeptidase 23B) The peptide sequence was selected from the N terminal of MMP23B. Peptide sequence ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MMP23B
Conjugate Unconjugated
Supplier Page Shop

Product images