Cklfsf8 Antibody

Name Cklfsf8 Antibody
Supplier Novus Biologicals
Catalog NBP1-59463
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CMTM8(CKLF-like MARVEL transmembrane domain containing 8) The peptide sequence was selected from the middle region of CMTM8. Peptide sequence CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CMTM8
Conjugate Unconjugated
Supplier Page Shop

Product images