Patched 2/PTCH2 Antibody

Name Patched 2/PTCH2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59457
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PTCH2(patched homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of PTCH2. Peptide sequence LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PTCH2
Conjugate Unconjugated
Supplier Page Shop

Product images