| Name | SLC25A46 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59565 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC25A46(solute carrier family 25, member 46) The peptide sequence was selected from the N terminal of SLC25A46. Peptide sequence RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC25A46 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |