ARV1 Antibody

Name ARV1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59542
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ARV1(ARV1 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of ARV1 (NP_073623). Peptide sequence: QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARV1
Conjugate Unconjugated
Supplier Page Shop

Product images