SLC25A35 Antibody

Name SLC25A35 Antibody
Supplier Novus Biologicals
Catalog NBP1-59606
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human SLC25A35. Peptide sequence: DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC25A35
Conjugate Unconjugated
Supplier Page Shop

Product images