MRS2 Antibody
| Name | MRS2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59614 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine |
| Antigen | Synthetic peptides corresponding to MRS2L The peptide sequence was selected from the middle region of MRS2L. Peptide sequence LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MRS2 |
| Supplier Page | Shop |
Product images
![Western Blot: MRS2 Antibody [NBP1-59614] - PANC1 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4040_MRS2%2520Antibody-Western%2520Blot-NBP1-59614-img0002.jpg)
Western Blot: MRS2 Antibody [NBP1-59614] - PANC1 cell lysate, concentration 0.2-1 ug/ml.