MMP23B Antibody

Name MMP23B Antibody
Supplier Novus Biologicals
Catalog NBP1-60036
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MMP23B(matrix metallopeptidase 23B) The peptide sequence was selected from the middle region of MMP23B. Peptide sequence QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MMP23B
Conjugate Unconjugated
Supplier Page Shop

Product images