ABHD13 Antibody

Name ABHD13 Antibody
Supplier Novus Biologicals
Catalog NBP1-60026
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ABHD13(abhydrolase domain containing 13) The peptide sequence was selected from the N terminal of ABHD13. Peptide sequence SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ABHD13
Conjugate Unconjugated
Supplier Page Shop

Product images