TETRAN Antibody
| Name | TETRAN Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59930 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TETRAN(tetracycline transporter-like protein) The peptide sequence was selected from the middle region of TETRAN. Peptide sequence APSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFL. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MFSD10 |
| Supplier Page | Shop |
![Western Blot: TETRAN Antibody [NBP1-59930] - Jurkat cell lysate, concentration 0.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4047_TETRAN%2520Antibody-Western%2520Blot-NBP1-59930-img0001.jpg)
![Immunohistochemistry-Paraffin: TETRAN Antibody [NBP1-59930] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4048_TETRAN%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59930-img0003.jpg)