RHBDL2 Antibody

Name RHBDL2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59971
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RHBDL2(rhomboid, veinlet-like 2 (Drosophila)) The peptide sequence was selected from the N terminal of RHBDL2 (NP_060291). Peptide sequence KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RHBDL2
Conjugate Unconjugated
Supplier Page Shop

Product images