RNFT2 Antibody

Name RNFT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-60000
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMEM118 The peptide sequence was selected from the N terminal of TMEM118. Peptide sequence HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RNFT2
Conjugate Unconjugated
Supplier Page Shop

Product images