C1orf177 Antibody

Name C1orf177 Antibody
Supplier Novus Biologicals
Catalog NBP1-70454
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C1ORF177 The peptide sequence was selected from the middle region of C1ORF177. Peptide sequence YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C1orf177
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.