SARG Antibody

Name SARG Antibody
Supplier Novus Biologicals
Catalog NBP1-70451
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to C1ORF116 The peptide sequence was selected from the middle region of C1ORF116. Peptide sequence SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene C1orf116
Supplier Page Shop

Product images