ARMC3 Antibody

Name ARMC3 Antibody
Supplier Novus Biologicals
Catalog NBP1-70412
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ARMC3(armadillo repeat containing 3) The peptide sequence was selected from the middle region of ARMC3. Peptide sequence YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARMC3
Conjugate Unconjugated
Supplier Page Shop

Product images