C17orf64 Antibody
| Name | C17orf64 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70442 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C17ORF64 The peptide sequence was selected from the middle region of C17ORF64. Peptide sequence NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C17orf64 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C17orf64 Antibody [NBP1-70442] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16479_C17orf64%2520Antibody-Western%2520Blot-NBP1-70442-img0003.jpg)
Western Blot: C17orf64 Antibody [NBP1-70442] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.