C14orf80 Antibody

Name C14orf80 Antibody
Supplier Novus Biologicals
Catalog NBP1-70436
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C14ORF80 The peptide sequence was selected from the n terminal of C14ORF80. Peptide sequence MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C14orf80
Conjugate Unconjugated
Supplier Page Shop

Product images