VEST1 Antibody

Name VEST1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70756
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Dog, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to C8ORF34 The peptide sequence was selected from the N terminal of C8ORF34. Peptide sequence MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene C8orf34
Supplier Page Shop

Product images