Name | VEST1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70756 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Pig, Dog, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to C8ORF34 The peptide sequence was selected from the N terminal of C8ORF34. Peptide sequence MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | C8orf34 |
Supplier Page | Shop |