XRRA1 Antibody

Name XRRA1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70749
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to XRRA1 (X-ray radiation resistance associated 1) The peptide sequence was selected from the N terminal of XRRA1)(50ug). Peptide sequence MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene XRRA1
Conjugate Unconjugated
Supplier Page Shop

Product images