WDR49 Antibody

Name WDR49 Antibody
Supplier Novus Biologicals
Catalog NBP1-70746
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to WDR49 (WD repeat domain 49) The peptide sequence was selected from the N terminal of WDR49)(50ug). Peptide sequence SQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene WDR49
Conjugate Unconjugated
Supplier Page Shop

Product images