RNF165 Antibody

Name RNF165 Antibody
Supplier Novus Biologicals
Catalog NBP1-70695
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RNF165(ring finger protein 165) The peptide sequence was selected from the N terminal of RNF165. Peptide sequence MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene RNF165
Conjugate Unconjugated
Supplier Page Shop

Product images