KRT84 Antibody

Name KRT84 Antibody
Supplier Novus Biologicals
Catalog NBP1-70762
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KRT84(keratin 84) The peptide sequence was selected from the middle region of KRT84. Peptide sequence ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KRT84
Conjugate Unconjugated
Supplier Page Shop

Product images