Ly-6G6F Antibody
| Name | Ly-6G6F Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70761 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LY6G6F The peptide sequence was selected from the N terminal of LY6G6F. Peptide sequence CSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEED. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | LY6G6F |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Ly-6G6F Antibody [NBP1-70761] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24512_Ly-6G6F-Antibody-Western-Blot-NBP1-70761-img0003.jpg)
Western Blot: Ly-6G6F Antibody [NBP1-70761] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: Ly-6G6F Antibody [NBP1-70761] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24513_Ly-6G6F-Antibody-Immunohistochemistry-Paraffin-NBP1-70761-img0004.jpg)
Immunohistochemistry-Paraffin: Ly-6G6F Antibody [NBP1-70761] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.