TSG-9 Antibody

Name TSG-9 Antibody
Supplier Novus Biologicals
Catalog NBP1-70738
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TUSC1(tumor suppressor candidate 1) The peptide sequence was selected from the middle region of TUSC1. Peptide sequence DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TUSC1
Conjugate Unconjugated
Supplier Page Shop

Product images