TRAPPC6B Antibody

Name TRAPPC6B Antibody
Supplier Novus Biologicals
Catalog NBP1-70736
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRAPPC6B(trafficking protein particle complex 6B) The peptide sequence was selected from the middle region of TRAPPC6B. Peptide sequence TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRAPPC6B
Conjugate Unconjugated
Supplier Page Shop

Product images