TRABD Antibody

Name TRABD Antibody
Supplier Novus Biologicals
Catalog NBP1-70734
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PP2447 The peptide sequence was selected from the N terminal of PP2447. Peptide sequence MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene TRABD
Conjugate Unconjugated
Supplier Page Shop

Product images