TCTEX1D4 Antibody

Name TCTEX1D4 Antibody
Supplier Novus Biologicals
Catalog NBP1-70720
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RP11-269F19.9 The peptide sequence was selected from the N terminal of RP11-269F19.9. Peptide sequence RGSMLGLAASFSRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TCTEX1D4
Conjugate Unconjugated
Supplier Page Shop

Product images