Name | SLC26A8 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70717 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC26A8(solute carrier family 26, member 8) The peptide sequence was selected from the C terminal of SLC26A8. Peptide sequence EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | SLC26A8 |
Conjugate | Unconjugated |
Supplier Page | Shop |