SLC26A8 Antibody
| Name | SLC26A8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70717 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC26A8(solute carrier family 26, member 8) The peptide sequence was selected from the C terminal of SLC26A8. Peptide sequence EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC26A8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SLC26A8 Antibody [NBP1-70717] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24881_SLC26A8-Antibody-Western-Blot-NBP1-70717-img0001.jpg)
![Immunohistochemistry-Paraffin: SLC26A8 Antibody [NBP1-70717] - Human Brain Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24882_SLC26A8-Antibody-Immunohistochemistry-Paraffin-NBP1-70717-img0002.jpg)