NOL1R2 Antibody

Name NOL1R2 Antibody
Supplier Novus Biologicals
Catalog NBP1-70655
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NSUN5C(NOL1/NOP2/Sun domain family, member 5C) The peptide sequence was selected from the middle region of NSUN5C. Peptide sequence PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene NSUN5P2
Conjugate Unconjugated
Supplier Page Shop

Product images