LCA5L Antibody
| Name | LCA5L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70597 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C21ORF13 The peptide sequence was selected from the N terminal of C21ORF13. Peptide sequence SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LCA5L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: LCA5L Antibody [NBP1-70597] - Antibody Titration: 5% Milk. Mouse Brain lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17_LCA5L-Antibody-Western-Blot-NBP1-70597-img0002.jpg)
![Western Blot: LCA5L Antibody [NBP1-70597] - MCF7 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/18_LCA5L%2520Antibody-Western%2520Blot-NBP1-70597-img0001.jpg)