KRT222 Antibody

Name KRT222 Antibody
Supplier Novus Biologicals
Catalog NBP1-70595
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KRT222P(keratin 222 pseudogene) The peptide sequence was selected from the N terminal of KRT222P. Peptide sequence ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KRT222
Conjugate Unconjugated
Supplier Page Shop

Product images