KLHDC8B Antibody

Name KLHDC8B Antibody
Supplier Novus Biologicals
Catalog NBP1-70591
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Bovine, Dog, Horse
Antigen Synthetic peptides corresponding to KLHDC8B(kelch domain containing 8B) The peptide sequence was selected from the N terminal of KLHDC8B. Peptide sequence MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene KLHDC8B
Supplier Page Shop

Product images