Name | KLHDC8B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70591 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Bovine, Dog, Horse |
Antigen | Synthetic peptides corresponding to KLHDC8B(kelch domain containing 8B) The peptide sequence was selected from the N terminal of KLHDC8B. Peptide sequence MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | KLHDC8B |
Supplier Page | Shop |