Connexin 36/GJD2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-70507
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CX36 The peptide sequence was selected from the middle region of CX36. Peptide sequence NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: GJD2
• Conjugate: Unconjugated