Connexin 30.3/GJB4 Antibody
| Name | Connexin 30.3/GJB4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70506 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GJB4 (gap junction protein, beta 4) The peptide sequence was selected from the middle region of GJB4. Peptide sequence CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | GJB4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Connexin 30.3/GJB4 Antibody [NBP1-70506] - Jurkat cell lysate, concentration 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16609_Connexin%252030.3-GJB4%2520Antibody-Western%2520Blot-NBP1-70506-img0002.jpg)
Western Blot: Connexin 30.3/GJB4 Antibody [NBP1-70506] - Jurkat cell lysate, concentration 1.25ug/ml.