METTL11B Antibody

Name METTL11B Antibody
Supplier Novus Biologicals
Catalog NBP1-70635
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C1ORF184 The peptide sequence was selected from the C terminal of C1ORF184. Peptide sequence NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene METTL11B
Conjugate Unconjugated
Supplier Page Shop

Product images