METTL11B Antibody
| Name | METTL11B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70635 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C1ORF184 The peptide sequence was selected from the C terminal of C1ORF184. Peptide sequence NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | METTL11B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: METTL11B Antibody [NBP1-70635] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29773_METTL11B-Antibody-Western-Blot-NBP1-70635-img0002.jpg)
![Western Blot: METTL11B Antibody [NBP1-70635] - Antibody Titration: 1 ug/ml Human HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29774_METTL11B%2520Antibody-Western%2520Blot-NBP1-70635-img0003.jpg)