LRRC52 Antibody

Name LRRC52 Antibody
Supplier Novus Biologicals
Catalog NBP1-70625
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LRRC52(leucine rich repeat containing 52) Antibody(against the N terminal of LRRC52. Peptide sequence QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LRRC52
Conjugate Unconjugated
Supplier Page Shop

Product images