ZCCHC12 Antibody

Name ZCCHC12 Antibody
Supplier Novus Biologicals
Catalog NBP1-54808
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZCCHC12(zinc finger, CCHC domain containing 12) The peptide sequence was selected from the N terminal of ZCCHC12. Peptide sequence AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZCCHC12
Conjugate Unconjugated
Supplier Page Shop

Product images