WDR9 Antibody

Name WDR9 Antibody
Supplier Novus Biologicals
Catalog NBP1-54801
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to BRWD1(bromodomain and WD repeat domain containing 1) The peptide sequence was selected from the N terminal of BRWD1. Peptide sequence MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene BRWD1
Conjugate Unconjugated
Supplier Page Shop

Product images