MAT1A Antibody
| Name | MAT1A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54893 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MAT1A(methionine adenosyltransferase I, alpha) The peptide sequence was selected from the C terminal of MAT1A. Peptide sequence VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | MAT1A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MAT1A Antibody [NBP1-54893] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7333_MAT1A-Antibody-Western-Blot-NBP1-54893-img0004.jpg)
![Western Blot: MAT1A Antibody [NBP1-54893] - Reccomended Titration: 2.5 ug/ml Positive Control: Human Liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7334_MAT1A%2520Antibody-Western%2520Blot-NBP1-54893-img0005.jpg)