Name | PRKRIP1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54890 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PRKRIP1(PRKR interacting protein 1 (IL11 inducible)) The peptide sequence was selected from the N terminal of PRKRIP1. Peptide sequence MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PRKRIP1 |
Conjugate | Unconjugated |
Supplier Page | Shop |