PRKRIP1 Antibody

Name PRKRIP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54890
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PRKRIP1(PRKR interacting protein 1 (IL11 inducible)) The peptide sequence was selected from the N terminal of PRKRIP1. Peptide sequence MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PRKRIP1
Conjugate Unconjugated
Supplier Page Shop

Product images