Asialoglycoprotein Receptor 2 Antibody
| Name | Asialoglycoprotein Receptor 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54888 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ASGR2 (asialoglycoprotein receptor 2) The peptide sequence was selected from the N terminal of ASGR2. Peptide sequence STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | ASGR2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Asialoglycoprotein Receptor 2 Antibody [NBP1-54888] - Sample Tissue: Human HepG2 Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1942_Asialoglycoprotein-Receptor-2-Antibody-Western-Blot-NBP1-54888-img0004.jpg)
Western Blot: Asialoglycoprotein Receptor 2 Antibody [NBP1-54888] - Sample Tissue: Human HepG2 Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: Asialoglycoprotein Receptor 2 Antibody [NBP1-54888] - Human Spleen](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1943_Asialoglycoprotein-Receptor-2-Antibody-Immunohistochemistry-NBP1-54888-img0003.jpg)
Immunohistochemistry: Asialoglycoprotein Receptor 2 Antibody [NBP1-54888] - Human Spleen
![Western Blot: Asialoglycoprotein Receptor 2 Antibody [NBP1-54888] - HepG2 cell lysate, Antibody Titration: 4.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1944_Asialoglycoprotein-Receptor-2-Antibody-Western-Blot-NBP1-54888-img0001.jpg)
Western Blot: Asialoglycoprotein Receptor 2 Antibody [NBP1-54888] - HepG2 cell lysate, Antibody Titration: 4.0ug/ml