NDUFA9 Antibody

Name NDUFA9 Antibody
Supplier Novus Biologicals
Catalog NBP1-54761
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NDUFA9(NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa) The peptide sequence was selected from the N terminal of NDUFA9. Peptide sequence QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NDUFA9
Conjugate Unconjugated
Supplier Page Shop

Product images