ACTRT2 Antibody

Name ACTRT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54626
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACTRT2(actin-related protein T2) The peptide sequence was selected from the C terminal of ACTRT2. Peptide sequence LDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACTRT2
Conjugate Unconjugated
Supplier Page Shop

Product images