MRPL15 Antibody

Name MRPL15 Antibody
Supplier Novus Biologicals
Catalog NBP1-54662
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MRPL15(mitochondrial ribosomal protein L15) The peptide sequence was selected from the N terminal of MRPL15. Peptide sequence KPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MRPL15
Conjugate Unconjugated
Supplier Page Shop

Product images