MRPS12 Antibody

Name MRPS12 Antibody
Supplier Novus Biologicals
Catalog NBP1-54647
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MRPS12(mitochondrial ribosomal protein S12) The peptide sequence was selected from the N terminal of MRPS12. Peptide sequence LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MRPS12
Conjugate Unconjugated
Supplier Page Shop

Product images