HBLD1 Antibody

Name HBLD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54718
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ISCA2(iron-sulfur cluster assembly 2 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of ISCA2. Peptide sequence RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ISCA2
Conjugate Unconjugated
Supplier Page Shop

Product images