A2BP1 Antibody

Name A2BP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54945
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human A2BP1 (NP_001135805). Peptide sequence NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RBFOX1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.